PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9136_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 282aa    MW: 31972.7 Da    PI: 6.5113
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9136_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-161764248
                                         SSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  2 grWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                         g+W++eEd +l+d+++++G+g +W + + + g++R++k+c++rw++yl
  cra_locus_9136_iso_5_len_1067_ver_3 17 GPWSPEEDAKLKDYIEKHGTGgNWIALPLKAGLKRCGKSCRLRWLNYL 64
                                         89********************************************97 PP

2Myb_DNA-binding36.41.2e-1171113246
                                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                          g ++ +Ed ++  ++   G++ W+ Ia+ ++ gRt++++k++w++
  cra_locus_9136_iso_5_len_1067_ver_3  71 GDFSDDEDRIICTLFSTIGSR-WSIIAAQLP-GRTDNDIKNYWNT 113
                                          679******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.3311164IPR017930Myb domain
SMARTSM007176.8E-111566IPR001005SANT/Myb domain
SuperFamilySSF466894.3E-2616111IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-241771IPR009057Homeodomain-like
PfamPF002496.9E-151764IPR001005SANT/Myb domain
CDDcd001673.31E-91864No hitNo description
PROSITE profilePS5129421.39465119IPR017930Myb domain
SMARTSM007172.5E-1169117IPR001005SANT/Myb domain
PfamPF002491.9E-1071113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2272119IPR009057Homeodomain-like
CDDcd001671.20E-773115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
XXXXXXXXXX XXXXXXGPWS PEEDAKLKDY IEKHGTGGNW IALPLKAGLK RCGKSCRLRW  60
LNYLRPNIKH GDFSDDEDRI ICTLFSTIGS RWSIIAAQLP GRTDNDIKNY WNTKLKKKLM  120
GMSQKRSQNS ITPNSILLDH QSLSLTSSSS SLPYPTLSFT GYQNYSIPST NNPPSVVIQG  180
QEGNYMMNSS IHHYQDHNSF LRFGSEVAAA AAASSSSSDD GSSIFINRFE DDQQKPIINY  240
DQNPSLDCSL EEIKQLISTN LTFNNNFFLD EIKIEEDKFT YY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25171198108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304464.13e-78PREDICTED: transcription factor RAX2
TrEMBLA0A068UF152e-80A0A068UF15_COFCA; Uncharacterized protein
STRINGGLYMA19G36830.15e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154